PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008226676.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 350aa    MW: 39314.2 Da    PI: 8.0173
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008226676.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.78.2e-52141391128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF Ptdeel+v+yL++kv+g +++l ++i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ 
  XP_008226676.1  14 LPPGFRFYPTDEELLVQYLCRKVAGYQFSL-QIIAEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT- 106
                     79***************************9.89***************7777799***********************************9999. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  XP_008226676.1 107 EGRKVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139
                     999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6610162IPR003441NAC domain
PROSITE profilePS5100560.10714162IPR003441NAC domain
PfamPF023657.0E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGVPETDPLS QLSLPPGFRF YPTDEELLVQ YLCRKVAGYQ FSLQIIAEID LYKFDPWVLP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITTEGRK VGIKKALVFY  120
IGKAPKGTKT NWIMHEYRLI EPSRKNGSSK LDEWVLCRIY KKSSSSAAQK PMTTSVSSIE  180
HSNGSSSSCS SQLDDVLEWL PEIDDRSFTL PRINSLKTLQ QQQEDSKLGF QTGSGNFDWA  240
SLAGFNVVPE LCPNNQPQQG QGQMNVNYSN NNDMYVPSIP PLCHVESPPE RLAKTVDEEV  300
QSGFRTQRVD NSGFFQNSNV MTQNFCNPTD PYGYGTRLGR SALGFGCGEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-11211664169NO APICAL MERISTEM PROTEIN
1ut4_B1e-11211664169NO APICAL MERISTEM PROTEIN
1ut7_A1e-11211664169NO APICAL MERISTEM PROTEIN
1ut7_B1e-11211664169NO APICAL MERISTEM PROTEIN
3swm_A1e-11211667172NAC domain-containing protein 19
3swm_B1e-11211667172NAC domain-containing protein 19
3swm_C1e-11211667172NAC domain-containing protein 19
3swm_D1e-11211667172NAC domain-containing protein 19
3swp_A1e-11211667172NAC domain-containing protein 19
3swp_B1e-11211667172NAC domain-containing protein 19
3swp_C1e-11211667172NAC domain-containing protein 19
3swp_D1e-11211667172NAC domain-containing protein 19
4dul_A1e-11211664169NAC domain-containing protein 19
4dul_B1e-11211664169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8227120.0KR822712.1 Prunus persica NAC transcription factor NAC5 (NAC5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008226676.10.0PREDICTED: NAC domain-containing protein 72-like
SwissprotQ93VY31e-135NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA0A0P0KU830.0A0A0P0KU83_PRUPE; NAC transcription factor NAC5
STRINGVIT_19s0014g03290.t011e-160(Vitis vinifera)
STRINGPOPTR_0011s12400.11e-160(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-128NAC family protein